Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A5 Peptide - N-terminal region

SLC6A5 Peptide - N-terminal region

Product Specifications

UniProt

Q4VAM4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC6A5 Rabbit Polyclonal Antibody (orb325098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-Human ERBB3/HER3 (MP-RM-1)
MBS1581220-01 0.1 mg

Research Grade Anti-Human ERBB3/HER3 (MP-RM-1)

Sign In for Pricing
View Details
Research Grade Anti-Human ERBB3/HER3 (MP-RM-1)
MBS1581220-02 1 mg

Research Grade Anti-Human ERBB3/HER3 (MP-RM-1)

Sign In for Pricing
View Details
Research Grade Anti-Human ERBB3/HER3 (MP-RM-1)
MBS1581220-03 5x 1 mg

Research Grade Anti-Human ERBB3/HER3 (MP-RM-1)

Sign In for Pricing
View Details
Nup155 3'UTR GFP Stable Cell Line
TU164432 1.0 mL

Nup155 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Purple sea urchin FoxL2 Rabbit Polyclonal Antibody
orb1819432 200 µL

Purple sea urchin FoxL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/1623), CF568 conjugate, 0.1mg/mL
BNC683804-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/1623), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details