Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A5 Peptide - N-terminal region

SLC6A5 Peptide - N-terminal region

Product Specifications

UniProt

Q4VAM4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC6A5 Rabbit Polyclonal Antibody (orb325098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2C Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
48949066 1.0 µg DNA

UBE2C Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral mouse Rnf25 shRNA (UAS) - Lentiviral mouse Rnf25 shRNA (UAS, RFP) plasmid
GTR15257377 1 Vial

Lentiviral mouse Rnf25 shRNA (UAS) - Lentiviral mouse Rnf25 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
CD105 Polyclonal Antibody
MBS2579198-01 0.025 mL

CD105 Polyclonal Antibody

Sign In for Pricing
View Details
CD105 Polyclonal Antibody
MBS2579198-02 0.1 mL

CD105 Polyclonal Antibody

Sign In for Pricing
View Details
CD105 Polyclonal Antibody
MBS2579198-03 5x 0.1 mL

CD105 Polyclonal Antibody

Sign In for Pricing
View Details
N myc interactor/NMI Rabbit Polyclonal Antibody (Fluoro594)
orb3077852 100 µg

N myc interactor/NMI Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details