Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collagen alpha-1 (IV) chain (Col4a1), partial

This Recombinant Mouse Collagen alpha-1 (IV) chain (Col4a1), partial spans the amino acid sequence from region 1445-1669aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IV)

UniProt

P02463

Expression Region

1445-1669aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research; Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Methyleugenitol
orb1683281 5 mg

8-Methyleugenitol

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) BPM3 Polyclonal Antibody
MBS7181047 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) BPM3 Polyclonal Antibody

Sign In for Pricing
View Details
N-Acetyl-D-mannosamine
C09351-25mg 25 mg

N-Acetyl-D-mannosamine

Sign In for Pricing
View Details
Anti-EIF5 Antibody Picoband®
A04623-2 100 µg/Vial

Anti-EIF5 Antibody Picoband®

Sign In for Pricing
View Details
PGAP1 (GPI Inositol-deacylase, Post-GPI Attachment to Proteins Factor 1, hPGAP1, UNQ3024/PRO9822) (FITC)
131198-FITC 100 µL

PGAP1 (GPI Inositol-deacylase, Post-GPI Attachment to Proteins Factor 1, hPGAP1, UNQ3024/PRO9822) (FITC)

Sign In for Pricing
View Details
DALRD3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
17648156 3x 1.0 µg DNA

DALRD3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details