Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Small proline-rich protein 2E (Sprr2e)

This Recombinant Mouse Small proline-rich protein 2E (Sprr2e) spans the amino acid sequence from region 1-76aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

O70556

Expression Region

1-76aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYQQQQCKQPCQPPPVCPPKKCPEPCPHPQCPEPCPPPKCPEPCPEPCPPPSYQQKCPPVQPPPPCQQKCPPKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR15B ORF Vector (Human) (pORF)
ORF023764 1.0 µg DNA

MIR15B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TSPYL4 shRNA Plasmid (m)
sc-154734-SH 20 µg

TSPYL4 shRNA Plasmid (m)

Sign In for Pricing
View Details
NUAK2 antibody
FNab05886 100 µg

NUAK2 antibody

Sign In for Pricing
View Details
Vangl1 CRISPR Activation Plasmid (m2)
sc-432882-ACT-2 20 µg

Vangl1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Hamp (NM_053469) Rat Tagged ORF Clone Lentiviral Particle
RR201919L4V 200 µL

Hamp (NM_053469) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-SURF1 Antibody Picoband® Fluoro550 Conjugated
A03678-2-Fluoro550 100 µg/Vial

Anti-SURF1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details