WDR48 Peptide - C-terminal region
WDR48 Peptide - C-terminal region
Product Specifications
Product Name Alternative
P80, UAF1, SPG60
UniProt
Q8TAF3
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_065890
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H00116173-P01-25ug 25 µg
Recombinant Human CMTM5 Protein - (Dry Ice)
Sign In for Pricing
View Details 
038573-ML750 100 µL
MPZL2, ID (MPZL2, EVA, EVA1, Myelin protein zero-like protein 2, Epithelial V-like antigen 1) (MaxLight 750) discontinued
Sign In for Pricing
View Details EKU09887 96 Tests
Mouse Growth Differentiation Factor 15 (GDF15) CLIA Kit
Sign In for Pricing
View Details