Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIT1 Peptide - middle region

NIT1 Peptide - middle region

Product Specifications

UniProt

Q86X76

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NIT1 Rabbit Polyclonal Antibody (orb589944) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001172021.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQKIYNCHVLLNSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Glucokinase ELISA Kit
MBS722963-01 48 Well

Rat Glucokinase ELISA Kit

Sign In for Pricing
View Details
Rat Glucokinase ELISA Kit
MBS722963-02 96 Well

Rat Glucokinase ELISA Kit

Sign In for Pricing
View Details
Rat Glucokinase ELISA Kit
MBS722963-03 5x 96 Well

Rat Glucokinase ELISA Kit

Sign In for Pricing
View Details
Rat Glucokinase ELISA Kit
MBS722963-04 10x 96 Well

Rat Glucokinase ELISA Kit

Sign In for Pricing
View Details
RACK1 Rabbit Polyclonal Antibody (HRP)
orb2125199 100 µL

RACK1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Perianal Swabs
MBS170616-01 1 Sample

Perianal Swabs

Sign In for Pricing
View Details