Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RACK1 Rabbit Polyclonal Antibody (HRP)

RACK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1

UniProt

P63244

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GNB2L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006089

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGTPBP1 Antibody
orb1333083 100 µg

AGTPBP1 Antibody

Sign In for Pricing
View Details
APBB1IP Mouse mAb
orb2717231-01 50 µL

APBB1IP Mouse mAb

Sign In for Pricing
View Details
APBB1IP Mouse mAb
orb2717231-02 100 µL

APBB1IP Mouse mAb

Sign In for Pricing
View Details
IL12A, CT (NK Cell Stimulatory Factor Chain 1, NKSF1, Cytotoxic Lymphocyte Maturation Factor 35kD Subunit, CLMF p35, IL-12 Subunit p35, Interleukin-12 Subunit alpha, IL-12A) (PE)
MBS6483016-01 0.2 mL

IL12A, CT (NK Cell Stimulatory Factor Chain 1, NKSF1, Cytotoxic Lymphocyte Maturation Factor 35kD Subunit, CLMF p35, IL-12 Subunit p35, Interleukin-12 Subunit alpha, IL-12A) (PE)

Sign In for Pricing
View Details
IL12A, CT (NK Cell Stimulatory Factor Chain 1, NKSF1, Cytotoxic Lymphocyte Maturation Factor 35kD Subunit, CLMF p35, IL-12 Subunit p35, Interleukin-12 Subunit alpha, IL-12A) (PE)
MBS6483016-02 5x 0.2 mL

IL12A, CT (NK Cell Stimulatory Factor Chain 1, NKSF1, Cytotoxic Lymphocyte Maturation Factor 35kD Subunit, CLMF p35, IL-12 Subunit p35, Interleukin-12 Subunit alpha, IL-12A) (PE)

Sign In for Pricing
View Details
KCY Antibody
orb127899-01 25 µg

KCY Antibody

Sign In for Pricing
View Details