Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1D Peptide - middle region

EEF1D Peptide - middle region

Product Specifications

Product Name Alternative

EF1D, EF-1D, FP1047

UniProt

P29692

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123525.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish ep300b Polyclonal Antibody
ARO-A21934-01 50 µg

Anti-Zebrafish ep300b Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Zebrafish ep300b Polyclonal Antibody
ARO-A21934-02 100 µg

Anti-Zebrafish ep300b Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Zebrafish ep300b Polyclonal Antibody
ARO-A21934-03 1 mg

Anti-Zebrafish ep300b Polyclonal Antibody

Sign In for Pricing
View Details
PRM1 (Sperm Protamine P1, Cysteine-rich Protamine) (MaxLight 490)
131835-ML490 100 µL

PRM1 (Sperm Protamine P1, Cysteine-rich Protamine) (MaxLight 490)

Sign In for Pricing
View Details
PJA1 Peptide - middle region
orb2001197 100 µg

PJA1 Peptide - middle region

Sign In for Pricing
View Details
DAB2 Rabbit mAb
MBS8603830-01 0.1 mL

DAB2 Rabbit mAb

Sign In for Pricing
View Details