Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PJA1 Peptide - middle region

PJA1 Peptide - middle region

Product Specifications

Product Name Alternative

RNF70, PRAJA1

UniProt

Q8NG27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001027568.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEGDNDSGHELMQPGVFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tulobuterol-d9 Hydrochloride
TRC-T897252-1MG 1 mg

Tulobuterol-d9 Hydrochloride

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF647 conjugate, 0.1mg/mL
BNC471283-500 1x 500 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PARP16 (NM_017851) Human Over-expression Lysate
LY402632 100 µg

PARP16 (NM_017851) Human Over-expression Lysate

Sign In for Pricing
View Details
Amberlite® IR120 (H+)
TRC-A576013-5G 5 g

Amberlite® IR120 (H+)

Sign In for Pricing
View Details
C1orf83 (TCEANC2) Mouse Monoclonal Antibody [Clone ID: OTI2B11]
CF809339 100 µg

C1orf83 (TCEANC2) Mouse Monoclonal Antibody [Clone ID: OTI2B11]

Sign In for Pricing
View Details
Human Solute Carrier Family 30 Member 8 (SLC30A8) ELISA Kit
RDR-SLC30A8-Hu-01 96 Tests

Human Solute Carrier Family 30 Member 8 (SLC30A8) ELISA Kit

Sign In for Pricing
View Details