Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TICAM2 Peptide - N-terminal region

TICAM2 Peptide - N-terminal region

Product Specifications

UniProt

Q86XR7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001157940.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HMGB1/HMG1 Protein (His Tag)
PKSH031684-01 100 µg

Recombinant Human HMGB1/HMG1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HMGB1/HMG1 Protein (His Tag)
PKSH031684-02 500 µg

Recombinant Human HMGB1/HMG1 Protein (His Tag)

Sign In for Pricing
View Details
Ammonium Geranyl Pyrophosphate Triammonium Salt
TRC-A634015-1MG 1 mg

Ammonium Geranyl Pyrophosphate Triammonium Salt

Sign In for Pricing
View Details
Recombinant Human MPO Protein (Trx Tag)
PDEH100571-01 20 µg

Recombinant Human MPO Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human MPO Protein (Trx Tag)
PDEH100571-02 100 µg

Recombinant Human MPO Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human MPO Protein (Trx Tag)
PDEH100571-03 500 µg

Recombinant Human MPO Protein (Trx Tag)

Sign In for Pricing
View Details