Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAB1 Peptide - N-terminal region

DAB1 Peptide - N-terminal region

Product Specifications

UniProt

O75553

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066566.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KEAP1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-4900R-BF680 100 µL

KEAP1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Mmu-miR-9769-3p miRNA Inhibitor
orb1869013-01 10 nmol

Mmu-miR-9769-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-9769-3p miRNA Inhibitor
orb1869013-02 20 nmol

Mmu-miR-9769-3p miRNA Inhibitor

Sign In for Pricing
View Details
PRC1 Rabbit Polyclonal Antibody
TA396914 100 µg

PRC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Bola1 shRNA (UAS) - Lentiviral mouse Bola1 shRNA (UAS, iRFP) (100)
GTR15277071 1 Vial

Lentiviral mouse Bola1 shRNA (UAS) - Lentiviral mouse Bola1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
DDX46 Rabbit Polyclonal Antibody (HRP)
orb3128802 100 µg

DDX46 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details