What is the catalog number for MRPL3 Peptide - middle region?

The catalog number for MRPL3 Peptide - middle region is orb1999375.

What sizes are available for MRPL3 Peptide - middle region?

MRPL3 Peptide - middle region is available in the following size(s): 100 µg.

Is MRPL3 Peptide - middle region in stock?

MRPL3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MRPL3 Peptide - middle region

Product Specifications

Product Name Alternative

MRL3, RPML3, COXPD9

UniProt

P09001

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009139.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDIGRVWPGTKMP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-14140PE 0.1 mL

Mouse Monoclonal Ctip1 Antibody (PCRP-BCL11A-1G10) [PE]

Sign In for Pricing

View Details

bs-4244R-BF405 100 µL

Jagged 2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing

View Details

LS136227-100ug 100 µg

EMID2 (COL26A1) (NM_133457) Human Over-expression Lysate

Sign In for Pricing

View Details

E-EL-H5518-01 24 Tests

Human Ang1-7 (Angiotensin 1-7) ELISA Kit

Sign In for Pricing

View Details

E-EL-H5518-02 48 Tests

Human Ang1-7 (Angiotensin 1-7) ELISA Kit

Sign In for Pricing

View Details

E-EL-H5518-03 96 Tests

Human Ang1-7 (Angiotensin 1-7) ELISA Kit

Sign In for Pricing

View Details