RPL12 Peptide - middle region
RPL12 Peptide - middle region
Product Specifications
Product Name Alternative
L12
UniProt
P30050
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_000967.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2937345-01 20 µg
Recombinant Streptococcus pneumoniae serotype 19F ATP synthase subunit c (atpE)
Sign In for Pricing
View Details orb2937345-02 100 µg
Recombinant Streptococcus pneumoniae serotype 19F ATP synthase subunit c (atpE)
Sign In for Pricing
View Details 
RR211541L3V 200 µL
Npff (NM_022586) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details bs-46012P-01 100 µg
Recombinant SARS-COV-2 Spike S1 (N501Y) Protein
Sign In for Pricing
View Details