Recombinant Streptococcus pneumoniae serotype 19F ATP synthase subunit c (atpE)
This Recombinant Streptococcus pneumoniae serotype 19F ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
B5E677
Expression Region
1-66
Origin
Streptococcus pneumoniae serotype 19F (strain G54)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
D1876-48K1 50 µg
Dectin-1, Blocking Peptide (C-type lectin domain family 7 member A, Dendritic cell-associated C-type lectin 1, DC-associated C-type lectin 1, Beta-glucan receptor, C-type lectin superfamily member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) discontinued
Sign In for Pricing
View Details 
