Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP8 Peptide - middle region

AKAP8 Peptide - middle region

Product Specifications

Product Name Alternative

AKAP-8, AKAP95, AKAP 95, AKAP-95

UniProt

O43823

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005849.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDGTGRKRKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPT1A Recombinant Rabbit monoclonal Antibody
HA750923 100 µL

CPT1A Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant FAK Monoclonal Antibody
AN301036L-01 50 µL

Recombinant FAK Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant FAK Monoclonal Antibody
AN301036L-02 100 µL

Recombinant FAK Monoclonal Antibody

Sign In for Pricing
View Details
MAP1D (METAP1D) Human Gene Knockout Kit (CRISPR)
KN420687 1 Kit

MAP1D (METAP1D) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4,7-Difluorobenzo[d]thiazol-2-amine
TRC-D258186-1G 1 g

4,7-Difluorobenzo[d]thiazol-2-amine

Sign In for Pricing
View Details
LHX4 (NM_033343) Human Over-expression Lysate
LY403244 100 µg

LHX4 (NM_033343) Human Over-expression Lysate

Sign In for Pricing
View Details