Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTP1 Peptide - middle region

GSTP1 Peptide - middle region

Product Specifications

Product Name Alternative

GstpiB

UniProt

P19157

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_038569.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTLIYTNYENGKNDYVKALPGHLKPFETLLSQNQGGKAFIVGDQISFADY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI3K Antibody (p85 beta) / PIK3R2
V9682-100UG 100 µg

PI3K Antibody (p85 beta) / PIK3R2

Sign In for Pricing
View Details
1700106J16Rik Double Nickase Plasmid (m)
sc-428827-NIC 20 µg

1700106J16Rik Double Nickase Plasmid (m)

Sign In for Pricing
View Details
RING Finger Protein 168 (RNF168, E3 Ubiquitin-protein Ligase RNF168, hRNF168) (MaxLight 750) discontinued
132669-ML750 100 µL

RING Finger Protein 168 (RNF168, E3 Ubiquitin-protein Ligase RNF168, hRNF168) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Campylobacter OmpA
117060 100 µg

Campylobacter OmpA

Sign In for Pricing
View Details
GPR137C shRNA Plasmid (m)
sc-145704-SH 20 µg

GPR137C shRNA Plasmid (m)

Sign In for Pricing
View Details
Podoplanin rabbit pAb
UB-GEN-12334 100 µL

Podoplanin rabbit pAb

Sign In for Pricing
View Details