Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD209D Peptide - middle region

CD209D Peptide - middle region

Product Specifications

Product Name Alternative

SIGNR3, SIGN-R3, mSIGNR3

UniProt

Q91ZW8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_570974.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DMHNEATWHWVDGSPLSPSFTRYWNRGEPNNVGDEDCAEFSGDGWNDLSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF640R conjugate, 0.1mg/mL
BNC401101-100 1x 100 µL

MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human PTH2/PTRH2 Protein (His Tag)
PKSH030587 100 µg

Recombinant Human PTH2/PTRH2 Protein (His Tag)

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (rATG5/2553), CF594 conjugate, 0.1mg/mL
BNC943642-500 1x 500 µL

ATG5 (Autophagy Marker) (rATG5/2553), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL13RA1 Human
OM296482-01 10 µg

IL13RA1 Human

Sign In for Pricing
View Details
IL13RA1 Human
OM296482-02 2 µg

IL13RA1 Human

Sign In for Pricing
View Details
IL13RA1 Human
OM296482-03 1 mg

IL13RA1 Human

Sign In for Pricing
View Details