Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP5Z1 Peptide - middle region

AP5Z1 Peptide - middle region

Product Specifications

Product Name Alternative

AP-5 complex subunit zeta-1

UniProt

O43299

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055670.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BG-TMR Conjugate
12558-AAT 1 mg

BG-TMR Conjugate

Sign In for Pricing
View Details
Recombinant Human RANK/TNFRSF11A Protein (His Tag)
PKSH032987-01 10 µg

Recombinant Human RANK/TNFRSF11A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human RANK/TNFRSF11A Protein (His Tag)
PKSH032987-02 50 µg

Recombinant Human RANK/TNFRSF11A Protein (His Tag)

Sign In for Pricing
View Details
Neurocan Antibody
KC-3297-01 50 μL

Neurocan Antibody

Sign In for Pricing
View Details
Neurocan Antibody
KC-3297-02 100 µL

Neurocan Antibody

Sign In for Pricing
View Details
Neurocan Antibody
KC-3297-03 1 mL

Neurocan Antibody

Sign In for Pricing
View Details