TPH2 Peptide - middle region
TPH2 Peptide - middle region
Product Specifications
Product Name Alternative
Ntph, AU043594
UniProt
Q8CGV2
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_775567.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLMYGTELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEET
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
31243064 1.0 µg DNA
MYL1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
CSB-EP878947HU-01 20 µg
Recombinant Human Vesicle-associated membrane protein-associated protein A (VAPA), partial
Sign In for Pricing
View Details CSB-EP878947HU-02 100 µg
Recombinant Human Vesicle-associated membrane protein-associated protein A (VAPA), partial
Sign In for Pricing
View Details CSB-EP878947HU-03 1 mg
Recombinant Human Vesicle-associated membrane protein-associated protein A (VAPA), partial
Sign In for Pricing
View Details