Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDHB Peptide - middle region

SDHB Peptide - middle region

Product Specifications

Product Name Alternative

0710008N11Rik

UniProt

Q9CQA3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075863.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDGLYECI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHETA1 Peptide - N-terminal region
orb2010782 100 µg

PHETA1 Peptide - N-terminal region

Sign In for Pricing
View Details
INHBB (Inhibin beta B Chain, Activin beta-B Chain, MGC157939) (MaxLight 550)
128515-ML550 100 µL

INHBB (Inhibin beta B Chain, Activin beta-B Chain, MGC157939) (MaxLight 550)

Sign In for Pricing
View Details
Actinin Alpha 4 (ACTN4) Magnetic Fluorescence Assay Kit
MBS2158446-01 96 Tests

Actinin Alpha 4 (ACTN4) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Actinin Alpha 4 (ACTN4) Magnetic Fluorescence Assay Kit
MBS2158446-02 5x 96 Tests

Actinin Alpha 4 (ACTN4) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Actinin Alpha 4 (ACTN4) Magnetic Fluorescence Assay Kit
MBS2158446-03 10x 96 Tests

Actinin Alpha 4 (ACTN4) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
MCM2 antibody
70R-50046 100 µL

MCM2 antibody

Sign In for Pricing
View Details