Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHETA1 Peptide - N-terminal region

PHETA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SES1, FAM109A, IPIP27A

UniProt

Q8N4B1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHETA1 Rabbit Polyclonal Antibody (orb581813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653272

Preservative

Lyophilized powder

AA Sequence

HRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Dengue virus DENV-2 (Strain New Guinea C/PUO-218 hybrid) E/Envelope Protein (Domain III) Monoclonal Antibody
E-AB-V1073-01 20 µL

Anti-Dengue virus DENV-2 (Strain New Guinea C/PUO-218 hybrid) E/Envelope Protein (Domain III) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Dengue virus DENV-2 (Strain New Guinea C/PUO-218 hybrid) E/Envelope Protein (Domain III) Monoclonal Antibody
E-AB-V1073-02 100 µL

Anti-Dengue virus DENV-2 (Strain New Guinea C/PUO-218 hybrid) E/Envelope Protein (Domain III) Monoclonal Antibody

Sign In for Pricing
View Details
ACK1 (TNK2) (N-term) Rabbit Polyclonal Antibody
AP17080PU-N 400 µL

ACK1 (TNK2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Peroxiredoxin 3 Recombinant Rabbit Monoclonal Antibody [JA53-21]
ET1704-92 100 µL

Peroxiredoxin 3 Recombinant Rabbit Monoclonal Antibody [JA53-21]

Sign In for Pricing
View Details
Perazine-d8 Dihydrochloride Salt
TRC-P285802-1MG 1 mg

Perazine-d8 Dihydrochloride Salt

Sign In for Pricing
View Details
CD79a (JCB117), CF647 conjugate, 0.1mg/mL
BNC470476-100 1x 100 µL

CD79a (JCB117), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details