Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC5A1 Peptide - N-terminal region

SLC5A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Sglt1

UniProt

Q8C3K6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_062784.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSPAVTATDAPIPSYERIRNAADISVIVIYFVVVMAVGLWAMFSTNRGTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem181a (NM_001033178) Mouse Tagged Lenti ORF Clone
MR221313L4 10 µg

Tmem181a (NM_001033178) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Anti PCK2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 200ul
IRBAMLPCK2AP396200UL 200 µL

Rabbit Anti PCK2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 200ul

Sign In for Pricing
View Details
CHRFAM7A Rabbit Polyclonal Antibody
orb513728 100 µg

CHRFAM7A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Htr5a (NM_013148) Rat Tagged ORF Clone Lentiviral Particle
RR207076L4V 200 µL

Htr5a (NM_013148) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD33 splicing modulator 1 (hydrochloride)
HY-144399A 1 Each

CD33 splicing modulator 1 (hydrochloride)

Sign In for Pricing
View Details
ZNF473 AAV Vector (Human) (CMV)
51546101 1 µg

ZNF473 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details