Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus mutans serotype c Glucosyltransferase-SI (gtfC), partial

This Recombinant Streptococcus mutans serotype c Glucosyltransferase-SI (gtfC), partial spans the amino acid sequence from region 426-597aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GTF-SI) (Dextransucrase) (Sucrose 6-glucosyltransferase)

UniProt

P13470

Expression Region

426-597aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TIGGYEFLLANDVDNSNPVVQAEQLNWLHFLMNFGNIYANDPDANFDSIRVDAVDNVDADLLQIAGDYLKAAKGIHKNDKAANDHLSILEAWSYNDTPYLHDDGDNMINMDNRLRLSLLYSLAKPLNQRSGMNPLITNSLVNRTDDNAETAAVPSYSFIRAHDSEVQDLIRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Hydroxy-4-(sulfooxy)benzenepropanoic Acid Bis-Sodium Salt
TRC-H372960-100MG 100 mg

3-Hydroxy-4-(sulfooxy)benzenepropanoic Acid Bis-Sodium Salt

Sign In for Pricing
View Details
TBC1D20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2340905 3x 1.0 µg

TBC1D20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Fluorescent Lactate Detection Kit
FLLACT100-2 100 Tests

Fluorescent Lactate Detection Kit

Sign In for Pricing
View Details
Recombinant CD8 Antibody (alpha chain) / Rabbit Monoclonal
orb533989-01 20 µg

Recombinant CD8 Antibody (alpha chain) / Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant CD8 Antibody (alpha chain) / Rabbit Monoclonal
orb533989-02 100 µg

Recombinant CD8 Antibody (alpha chain) / Rabbit Monoclonal

Sign In for Pricing
View Details
Car5a Protein Vector (Mouse) (pPB-N-His)
PV161535 500 ng

Car5a Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details