Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus mitis Manganese ABC transporter substrate-binding lipoprotein (psaA)

This Recombinant Streptococcus mitis Manganese ABC transporter substrate-binding lipoprotein (psaA) spans the amino acid sequence from region 20-309aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Pneumococcal surface adhesin A)

UniProt

Q9L5X0

Expression Region

20-309aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Streptococcus mitis

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CASGKKDAASGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFSKLVENAKKTENKDYFAVSEGVDVIYLEGKNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNNIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTDSIAEQGKEGDSYYNMMKYNLDKIAEGLAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal FOXL2 Antibody (FOXL2/8362R) [Janelia Fluor 585]
NBP3-20966JF585 0.1 mL

Rabbit Monoclonal FOXL2 Antibody (FOXL2/8362R) [Janelia Fluor 585]

Sign In for Pricing
View Details
PF-5190457
522485 5.0mg

PF-5190457

Sign In for Pricing
View Details
Neutrophil Elastase (ELANE) (NM_001972) Human Recombinant Protein
PH30876E6 50 µg

Neutrophil Elastase (ELANE) (NM_001972) Human Recombinant Protein

Sign In for Pricing
View Details
Human BAHCC1 shRNA Plasmid
abx961569-01 150 µg

Human BAHCC1 shRNA Plasmid

Sign In for Pricing
View Details
Human BAHCC1 shRNA Plasmid
abx961569-02 300 µg

Human BAHCC1 shRNA Plasmid

Sign In for Pricing
View Details
Crebzf (NM_145151) Mouse Tagged ORF Clone
MG224172 10 µg

Crebzf (NM_145151) Mouse Tagged ORF Clone

Sign In for Pricing
View Details