Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1)

This Recombinant Mouse Collagen triple helix repeat-containing protein 1 (Cthrc1) spans the amino acid sequence from region 33-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9D1D6

Expression Region

33-245aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galanthamine hydrobromide 500mg
A10416-500 500 mg

Galanthamine hydrobromide 500mg

Sign In for Pricing
View Details
ZNF564 cDNA Clone
MBS1272487-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

ZNF564 cDNA Clone

Sign In for Pricing
View Details
ZNF564 cDNA Clone
MBS1272487-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

ZNF564 cDNA Clone

Sign In for Pricing
View Details
ER degrader 3
HY-142927 1 Each

ER degrader 3

Sign In for Pricing
View Details
4',7-Dimethoxy-5-Hydroxyflavone
C09742 5 mg

4',7-Dimethoxy-5-Hydroxyflavone

Sign In for Pricing
View Details
OCM Antibody
OACD06199-1ML 1 mL

OCM Antibody

Sign In for Pricing
View Details