Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Histamine H2 receptor (HRH2), partial

This Recombinant Gorilla gorilla gorilla Histamine H2 receptor (HRH2), partial spans the amino acid sequence from region 290-359aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(H2R) (HH2R) (Gastric receptor I)

UniProt

Q76MS7

Expression Region

290-359aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Gorilla gorilla gorilla (Western lowland gorilla)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VPS41 Antibody Picoband® Fluoro488 Conjugated
A04135-2-Fluoro488 100 µg/Vial

Anti-VPS41 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
ADAM28 (NM_021777) Human Over-expression Lysate
LH17663V 100 µg

ADAM28 (NM_021777) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc47a1 Mouse shRNA Lentiviral Particle (Locus ID 67473)
TL515788V 500 µL Each

Slc47a1 Mouse shRNA Lentiviral Particle (Locus ID 67473)

Sign In for Pricing
View Details
Recombinant Bovine Protein HP-20 homolog
MBS1469546-01 0.02 mg (E-Coli)

Recombinant Bovine Protein HP-20 homolog

Sign In for Pricing
View Details
Recombinant Bovine Protein HP-20 homolog
MBS1469546-02 0.1 mg (E-Coli)

Recombinant Bovine Protein HP-20 homolog

Sign In for Pricing
View Details
Recombinant Bovine Protein HP-20 homolog
MBS1469546-03 0.02 mg (Yeast)

Recombinant Bovine Protein HP-20 homolog

Sign In for Pricing
View Details