Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Interferon gamma (IFNG)

This Recombinant Macaca fascicularis Interferon gamma (IFNG) spans the amino acid sequence from region 24-165aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IFN-gamma)

UniProt

P63309

Expression Region

24-165aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Glutamic acid-15N
HY-14608S2-01 5 mg

L-Glutamic acid-15N

Sign In for Pricing
View Details
L-Glutamic acid-15N
HY-14608S2-02 10 mg

L-Glutamic acid-15N

Sign In for Pricing
View Details
RpoC2 Antibody
orb803754 2 mg

RpoC2 Antibody

Sign In for Pricing
View Details
LOC362921 Adenovirus (Rat)
27161056 1.0 mL

LOC362921 Adenovirus (Rat)

Sign In for Pricing
View Details
SEPP1, ID (SEPP1, SELP, Selenoprotein P) (MaxLight 405)
MBS6346113-01 0.1 mL

SEPP1, ID (SEPP1, SELP, Selenoprotein P) (MaxLight 405)

Sign In for Pricing
View Details
SEPP1, ID (SEPP1, SELP, Selenoprotein P) (MaxLight 405)
MBS6346113-02 5x 0.1 mL

SEPP1, ID (SEPP1, SELP, Selenoprotein P) (MaxLight 405)

Sign In for Pricing
View Details