Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8

This Recombinant Ganoderma lucidum Immunomodulatory protein Ling Zhi-8 spans the amino acid sequence from region 2-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(LZ-8)

UniProt

P14945

Expression Region

2-111aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Ganoderma lucidum (Ling zhi medicinal fungus) (Bracket fungus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDTALIFRLAWDVKKLSFDYTPNWGRGNPNNFIDTVTFPKVLTDKAYTYRVAVSGRNLGVKPSYAVESDGSQKVNFLEYNSGYGIADTNTIQVFVVDPDTNNDFIIAQWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEAL9 Peptide - N-terminal region
MBS3227055-01 0.1 mg

TCEAL9 Peptide - N-terminal region

Sign In for Pricing
View Details
TCEAL9 Peptide - N-terminal region
MBS3227055-02 5x 0.1 mg

TCEAL9 Peptide - N-terminal region

Sign In for Pricing
View Details
Ints9 Mouse qPCR Primer Pair (NM_153414)
MP206612 200 Reactions

Ints9 Mouse qPCR Primer Pair (NM_153414)

Sign In for Pricing
View Details
MAPKAPK2 Rabbit Monoclonal Antibody [Clone ID: 23GB2820]
TA424958S 20 µL

MAPKAPK2 Rabbit Monoclonal Antibody [Clone ID: 23GB2820]

Sign In for Pricing
View Details
SAP30 Antibody
58-906 400 µL

SAP30 Antibody

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2092508-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details