Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transforming growth factor beta-2 (TGFB2), partial

This Recombinant Bovine Transforming growth factor beta-2 (TGFB2), partial spans the amino acid sequence from region 303-414aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Milk growth factor) (MGF) (LAP) (TGF-beta-2)

UniProt

P21214

Expression Region

303-414aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDC0994
sc-507297 10 mg

GDC0994

Sign In for Pricing
View Details
MIU Medium Base
M1076-100G 100 g

MIU Medium Base

Sign In for Pricing
View Details
Mouse recombinant M-CSF (Macrophage colony-stimulating factor) protein, AF
PROTP07141-3-5ug 5 µg

Mouse recombinant M-CSF (Macrophage colony-stimulating factor) protein, AF

Sign In for Pricing
View Details
PerCP-Cy5.5 Anti-Mouse H-2 Antibody (M1/42)
PCP55-30191-01 50 Tests

PerCP-Cy5.5 Anti-Mouse H-2 Antibody (M1/42)

Sign In for Pricing
View Details
PerCP-Cy5.5 Anti-Mouse H-2 Antibody (M1/42)
PCP55-30191-02 100 Tests

PerCP-Cy5.5 Anti-Mouse H-2 Antibody (M1/42)

Sign In for Pricing
View Details
Human GBA3 Protein Lysate
MBS8412140-01 0.02 mg

Human GBA3 Protein Lysate

Sign In for Pricing
View Details