Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant M-CSF (Macrophage colony-stimulating factor) protein, AF

Macrophage Colony-Stimulating Factor (M-CSF) is a 19.02 kDa hematopoietic Growth Factors with 162 amino acid residues. The active form of the protein is homodimer, and secreted by osteoblasts. M-CSF controls the production, differentiation, and function of monocytes, macrophages, and bone marrow progenitor cells. M-CSF is able to activate CSF-1 signaling pathway via binding its receptor CSF-1R.

Product Specifications

Synonyms

CSF-1, MGI-IM

Gene Name

CCL3

UniProt

P07141

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <2 ng/mL. The specific activity of recombinant mouse M-CSF is approximately >5 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.02 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP withpolyhistidine tag at the C-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin-7 Receptor Subunit Alpha (CD127) Antibody (PE)
abx200684-01 25 µg

Interleukin-7 Receptor Subunit Alpha (CD127) Antibody (PE)

Sign In for Pricing
View Details
Interleukin-7 Receptor Subunit Alpha (CD127) Antibody (PE)
abx200684-02 100 µg

Interleukin-7 Receptor Subunit Alpha (CD127) Antibody (PE)

Sign In for Pricing
View Details
Mouse 25-Dihydroxy vitamin D3,HVD3 ELISA KIT
JOT-EKA0109Mo 96 wells

Mouse 25-Dihydroxy vitamin D3,HVD3 ELISA KIT

Sign In for Pricing
View Details
CD1a (66IIC7), CF488A conjugate, 0.1mg/mL
BNC881034-500 1x 500 µL

CD1a (66IIC7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CXCL2 (Gro beta, MIP-2) (Biotin)
MBS6470977-01 0.1 mL

CXCL2 (Gro beta, MIP-2) (Biotin)

Sign In for Pricing
View Details
CXCL2 (Gro beta, MIP-2) (Biotin)
MBS6470977-02 5x 0.1 mL

CXCL2 (Gro beta, MIP-2) (Biotin)

Sign In for Pricing
View Details