Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage Receptor MARCO/MARCO (N-8His)

Recombinant Mouse Macrophage Receptor MARCO/MARCO (N-8His)

Product Specifications

UniProt

Q60754

Reactivity

Mouse

Field of Research

Immunology & Inflammation

Endotoxin

Less than 0.1 ng, μg (1 IEU, μg) as determined by LAL test.

Purity

Greater than 95%

Molecular Weight

46.2kDa

Storage Conditions

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Notes

For research use only.

Preservative

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4

AA Sequence

HHHHHHHHQVLNLQEQLQMLEMCCGNGSLAIEDKPFFSLQWAPKTHLVPRAQGLQALQAQLSWVHTSQEQLRQQFNNLTQNPELFQIKGERGSPGPKGAPGAPGIPGLPGPAAEKGEKGAAGRDGTPGVQGPQGPPGSKGEAGLQGLTGAPGKQGATGAPGPRGEKGSKGDIGLTGPKGEHGTKGDKGDLGLPGNKGDMGMKGDTGPMGSPGAQGGKGDAGKPGLPGLAGSPGVKGDQGKPGVQGVPGPQGAPGLSGAKGEPGRTGLPGPAGPPGIAGNPGIAGVKGSKGDTGIQGQKGTKGESGVPGLVGRKGDTGSPGLAGPKGEPGRVGQKGDPGMKGSSGQQGQKGEKGQKGESFQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD2AP Polyclonal Antibody
E-AB-16309-01 20 µL

CD2AP Polyclonal Antibody

Sign In for Pricing
View Details
CD2AP Polyclonal Antibody
E-AB-16309-02 60 µL

CD2AP Polyclonal Antibody

Sign In for Pricing
View Details
CD2AP Polyclonal Antibody
E-AB-16309-03 120 µL

CD2AP Polyclonal Antibody

Sign In for Pricing
View Details
CD2AP Polyclonal Antibody
E-AB-16309-04 200 µL

CD2AP Polyclonal Antibody

Sign In for Pricing
View Details
4-Chlorobenzeneboronic Acid
TRC-C364565-25G 25 g

4-Chlorobenzeneboronic Acid

Sign In for Pricing
View Details
CASQ2 (NM_001232) Human Recombinant Protein
TP304695M 100 µg

CASQ2 (NM_001232) Human Recombinant Protein

Sign In for Pricing
View Details