Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD174 Recombinant Protein

CD174 Recombinant Protein

Product Specifications

UniProt

P21217

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~42kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

MRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTMR14 antibody
10R-4897 100 µL

MTMR14 antibody

Sign In for Pricing
View Details
Recombinant Mouse GA-binding protein alpha chain (Gabpa)
MBS9020520-01 0.02 mg (E-Coli)

Recombinant Mouse GA-binding protein alpha chain (Gabpa)

Sign In for Pricing
View Details
Recombinant Mouse GA-binding protein alpha chain (Gabpa)
MBS9020520-02 0.1 mg (E-Coli)

Recombinant Mouse GA-binding protein alpha chain (Gabpa)

Sign In for Pricing
View Details
Recombinant Mouse GA-binding protein alpha chain (Gabpa)
MBS9020520-03 1 mg (E-Coli)

Recombinant Mouse GA-binding protein alpha chain (Gabpa)

Sign In for Pricing
View Details
Recombinant Mouse GA-binding protein alpha chain (Gabpa)
MBS9020520-04 5x 1 mg (E-Coli)

Recombinant Mouse GA-binding protein alpha chain (Gabpa)

Sign In for Pricing
View Details
RPL39P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV781161 1.0 µg DNA

RPL39P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details