What is the catalog number for RecombinantCT-1, Human?

The catalog number for RecombinantCT-1, Human is orb1494756.

What sizes are available for RecombinantCT-1, Human?

RecombinantCT-1, Human is available in the following size(s): 10 µg, 50 µg.

How many pack sizes does RecombinantCT-1, Human come in?

RecombinantCT-1, Human is available in 2 different pack sizes.

Is RecombinantCT-1, Human in stock?

RecombinantCT-1, Human is currently made to order / not held in immediate stock. Contact us for lead time.

RecombinantCT-1, Human

Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Human CT-1 is a 21.1 kDa protein consisting of 200 amino acid residues.

Product Specifications

Product Name Alternative

CT1

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.4 ng/ml, measured in a cell proliferation assay using TF-1 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

24~26kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Cardiotrophin-1°CT-1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Cardiotrophin-1°CT-1) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGL PVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASA ASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA