Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1E1 (OR1E1)

This Recombinant Human Olfactory receptor 1E1 (OR1E1) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1E1, Olfactory receptor 13-66, OR13-66, Olfactory receptor 17-2/17-32, OR17-2, OR17-32, Olfactory receptor 1E5, Olfactory recep

UniProt

P30953

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY DRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFST CGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA LSRVIHQKKTFFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Ndufs1 Antibody
NBP1-56520 100 µL

Rabbit Polyclonal Ndufs1 Antibody

Sign In for Pricing
View Details
Diethyl Sulfate
12315-62 25 mL

Diethyl Sulfate

Sign In for Pricing
View Details
Nicotinamide phosphoribosyltransferase
325901 100 µL

Nicotinamide phosphoribosyltransferase

Sign In for Pricing
View Details
Human Endothelial nitric oxide synthase ELISA Kit
ELA-E0868h 96 Tests

Human Endothelial nitric oxide synthase ELISA Kit

Sign In for Pricing
View Details
MHF1/CENPS Rabbit pAb
E47R18928 100 µL

MHF1/CENPS Rabbit pAb

Sign In for Pricing
View Details
Dcun1d1 (NM_033623) Mouse Recombinant Protein
TP503034 20 µg

Dcun1d1 (NM_033623) Mouse Recombinant Protein

Sign In for Pricing
View Details