Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantM-CSF, Human (CHO-expressed)

Human Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers.

Product Specifications

Product Name Alternative

Macrophage Colony Stimulating Factor, CSF-1, Lanimostim, MCSF, M-CSF

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2x10ˆ5 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

32-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Macrophage-Colony Stimulating Factor (rhM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQL QELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MMP-2 Monoclonal Antibody
AN300112P 100 µL

Recombinant MMP-2 Monoclonal Antibody

Sign In for Pricing
View Details
FGF23 (Fibroblast Growth Factor 23, FGF-23, Phosphatonin, Tumor-derived Hypophosphatemia-inducing Factor, HYPF, UNQ3027/PRO9828, ADHR, HPDR2, PHPTC)
140285 200 µL

FGF23 (Fibroblast Growth Factor 23, FGF-23, Phosphatonin, Tumor-derived Hypophosphatemia-inducing Factor, HYPF, UNQ3027/PRO9828, ADHR, HPDR2, PHPTC)

Sign In for Pricing
View Details
CD3D-CD3E Heterodimer , Mouse (Biotinylated, HEK293, His-Avi)
HY-P705111-01 25 µg

CD3D-CD3E Heterodimer , Mouse (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
CD3D-CD3E Heterodimer , Mouse (Biotinylated, HEK293, His-Avi)
HY-P705111-02 200 µg

CD3D-CD3E Heterodimer , Mouse (Biotinylated, HEK293, His-Avi)

Sign In for Pricing
View Details
Breast Tissue Slide (Ductal Carcinoma In Situ (DCIS))
MBS154217-01 4 um

Breast Tissue Slide (Ductal Carcinoma In Situ (DCIS))

Sign In for Pricing
View Details
Breast Tissue Slide (Ductal Carcinoma In Situ (DCIS))
MBS154217-02 10 um

Breast Tissue Slide (Ductal Carcinoma In Situ (DCIS))

Sign In for Pricing
View Details