Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIGF-BP-2, His, Human

IGF-BP-2, also known as Insulin-like growth factor-binding protein 2, IBP-2 and BP-2, is a cysteine-rich secreted protein belonging to the IGF-binding protein superfamily. It is expressed by the central nervous system, bone cells and reproductive tissues. IGF-BP-2 binds to both IGF-I and IGF-II, with a much higher binding affinity to IGF-II than IGF-I. IGF-BP-2 has been shown to inhibitand stimulate the growth promoting effects of IGFs, thus serving as a regulator for IGF distribution, function and activity.

Product Specifications

Product Name Alternative

Insulin-like growth factor-binding protein 2, IBP-2, BP-2

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 2 μg/ml, measured in a bioassay using FDC-P1 cells in the presence of 15 ng/ml human IGF-II.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

6-20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IGF-BP-2, Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human IGF-BP-2, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

FRCPPCTPERLAACGPPPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSEL PLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQH RQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQ RGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H3A more Recombinant Protein
OPCD03783-50UG 50 µg

HIST1H3A more Recombinant Protein

Sign In for Pricing
View Details
Vmn2r5 (NM_001104618) Mouse Tagged Lenti ORF Clone
MR213005L3 10 µg

Vmn2r5 (NM_001104618) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RGD1561849 CRISPRa sgRNA lentivector (set of three targets)(Rat)
39259126 3x 1.0µg DNA

RGD1561849 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
MK-571 sodium
T3148-01 2 mg

MK-571 sodium

Sign In for Pricing
View Details
MK-571 sodium
T3148-02 5 mg

MK-571 sodium

Sign In for Pricing
View Details
MK-571 sodium
T3148-03 1 mL - 10 mM (in DMSO)

MK-571 sodium

Sign In for Pricing
View Details