Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIGF-BP-4, His, Human

Insulin-like growth factor-binding protein 4 (IGF-BP-4), also known as IBP-4, is a secreted glycoprotein belonging to the IGFBP family. IGF-BP-4 is produced by osteoblasts, epidermis, ovarian follicles and other tissues. It binds both insulin-like growth factor (IGF) I and II, and it circulates in the plasma in both glycosylated and non-glycosylated forms. IGF-BP-4 prolongs the half-life of the IGFs and has been shown to inhibit or stimulate the growth-promoting effects of the IGFs. Pregnancy Associated Plasma Protein A (PAPP-A) proteolytically cleaves IGF-BP-4 and reduces its affinity to bind IGFs, and thus serves as an important regulator of IGF-BP-4 function.

Product Specifications

Product Name Alternative

Insulin-like Growth Factor-Binding Protein 4, IBP-4, HT29-IGF-BP, colon cancer cell growth inhibitor

Source

HEK 293

Field of Research

Signal Transduction

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 50 ng/ml, measured in a bioassay using FDC-P1 cells in the presence of 15ng/ml human IGF-II.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

30-35 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IGF-BP-4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human IGF-BP-4, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCM ELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRA LERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFREHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAMDC2 Lentiviral Activation Particles (h2)
sc-415243-LAC-2 200 µL

MAMDC2 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Anti-Hu CD367 PE
MBS1802351-01 100 Tests

Anti-Hu CD367 PE

Sign In for Pricing
View Details
Anti-Hu CD367 PE
MBS1802351-02 5x 100 Tests

Anti-Hu CD367 PE

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae proQ Protein (aa 1-208) (strain ATCC 39541 / Ogawa 395 / O395)
VAng-Cr3092-500gEcoli 500 µg (E. coli)

Recombinant Vibrio Cholerae proQ Protein (aa 1-208) (strain ATCC 39541 / Ogawa 395 / O395)

Sign In for Pricing
View Details
Anti-EMR2 (L160) ADGRE2 Antibody
A08546-1 100 µL

Anti-EMR2 (L160) ADGRE2 Antibody

Sign In for Pricing
View Details
A4GALT Antibody - middle region : HRP (ARP47302_P050-HRP)
ARP47302_P050-HRP 100 µL

A4GALT Antibody - middle region : HRP (ARP47302_P050-HRP)

Sign In for Pricing
View Details