Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantSCF, Rat (HEK293-expressed)

Stem Cell Factor (SCF) is a hematopoietic growth factor that binds to the c-Kit receptor. SCF exerts its activity during the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.

Product Specifications

Product Name Alternative

C-Kit Ligand, Mast Cell Growth Factor (MGF), Steel Factor

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 50 ng/ml, measured in a proliferation assay using TF-1 Cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

10~20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Stem Cell Factor (SCF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Stem Cell Factor (SCF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLG KIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFML PPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC85A Peptide - N-terminal region
orb2006291 100 µg

CCDC85A Peptide - N-terminal region

Sign In for Pricing
View Details
AFF4 (N) Antibody, Rabbit Polyclonal
orb386731 100 µL

AFF4 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
NME1 (Nucleoside Diphosphate Kinase A, Granzyme A-activated DNase, GAAD, Metastasis Inhibition Factor nm23, NB, NBS, NDPKA, NDPK-A, NDP Kinase A, NM23, nm23-H1, NM23-H1, Tumor Metastatic Process-associated Protein)
N7100-61 100 µg

NME1 (Nucleoside Diphosphate Kinase A, Granzyme A-activated DNase, GAAD, Metastasis Inhibition Factor nm23, NB, NBS, NDPKA, NDPK-A, NDP Kinase A, NM23, nm23-H1, NM23-H1, Tumor Metastatic Process-associated Protein)

Sign In for Pricing
View Details
Recombinant Human Protein ABHD11 (ABHD11)
RPC31529-01 20 µg

Recombinant Human Protein ABHD11 (ABHD11)

Sign In for Pricing
View Details
Recombinant Human Protein ABHD11 (ABHD11)
RPC31529-02 100 µg

Recombinant Human Protein ABHD11 (ABHD11)

Sign In for Pricing
View Details
Recombinant Human Protein ABHD11 (ABHD11)
RPC31529-03 1 mg

Recombinant Human Protein ABHD11 (ABHD11)

Sign In for Pricing
View Details