Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC85A Peptide - N-terminal region

CCDC85A Peptide - N-terminal region

Product Specifications

UniProt

Q96PX6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC85A Rabbit Polyclonal Antibody (orb326746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073902

Preservative

Lyophilized powder

AA Sequence

AMLDHSNLIREVNRRLQLHLGEIRGLKDINQKLQEDNQELRDLCCFLDDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LYK5 Antibody [DyLight 755]
NBP2-99336IR 0.1 mL

Rabbit Polyclonal LYK5 Antibody [DyLight 755]

Sign In for Pricing
View Details
Human Protein TANC1 (TANC1) ELISA Kit
orb1656562-01 48 Tests

Human Protein TANC1 (TANC1) ELISA Kit

Sign In for Pricing
View Details
Human Protein TANC1 (TANC1) ELISA Kit
orb1656562-02 96 Tests

Human Protein TANC1 (TANC1) ELISA Kit

Sign In for Pricing
View Details
Human TNF alpha Val77-Leu233 Recombinant Protein Tag Free Lyophilized 50UG
IHUTNFAVAL77LEU233RTFLY50UG 50 µg

Human TNF alpha Val77-Leu233 Recombinant Protein Tag Free Lyophilized 50UG

Sign In for Pricing
View Details
MSBP2 Adenovirus (Human)
30727051 1.0 mL

MSBP2 Adenovirus (Human)

Sign In for Pricing
View Details
CBX5 Antibody
orb688538 100 µL

CBX5 Antibody

Sign In for Pricing
View Details