Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TFPI Protein

This Human TFPI Protein spans the amino acid sequence from region 29-280aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Extrinsic pathway inhibitor , EPILipoprotein-associated coagulation inhibitor , LACI

UniProt

P10646

Expression Region

29-280aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS3 polyclonal antibody
BS6055-01 50 µL

SOCS3 polyclonal antibody

Sign In for Pricing
View Details
SOCS3 polyclonal antibody
BS6055-02 100 µL

SOCS3 polyclonal antibody

Sign In for Pricing
View Details
Aconitase 1 (ACO1) Human Gene Knockout Kit (CRISPR)
KN201857BN 1 Kit

Aconitase 1 (ACO1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GCKR Antibody
A47879-100UL 100 µL

GCKR Antibody

Sign In for Pricing
View Details
STFR W016-600x200-PE-CRD/1 AC Signs
828704 Card of 1 Pictogram(s)

STFR W016-600x200-PE-CRD/1 AC Signs

Sign In for Pricing
View Details
1-Bromo-4-ethoxy-2-fluorobenzene
HEA71366 5 g

1-Bromo-4-ethoxy-2-fluorobenzene

Sign In for Pricing
View Details