Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hantaan virus Envelopment polyprotein Protein

This Hantaan virus Envelopment polyprotein Protein spans the amino acid sequence from region 649-1105aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Glycoprotein precursor) (M polyprotein)

UniProt

P08668

Expression Region

649-1105aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Hantaan virus (strain 76-118) (Korean hemorrhagic fever virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SETPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPSDCPGVGTGCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGEDCSQIGLHAAAPHLDKVNGISEIENSKVYDDGAPQCGIKCWFVKSGEWISGIFSGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Eukaryotic Translation Initiation Factor 2 Subunit 2 (EIF2S2) ELISA Kit
MBS9913164-01 48 Well

Horse Eukaryotic Translation Initiation Factor 2 Subunit 2 (EIF2S2) ELISA Kit

Sign In for Pricing
View Details
Horse Eukaryotic Translation Initiation Factor 2 Subunit 2 (EIF2S2) ELISA Kit
MBS9913164-02 96 Well

Horse Eukaryotic Translation Initiation Factor 2 Subunit 2 (EIF2S2) ELISA Kit

Sign In for Pricing
View Details
Horse Eukaryotic Translation Initiation Factor 2 Subunit 2 (EIF2S2) ELISA Kit
MBS9913164-03 5x 96 Well

Horse Eukaryotic Translation Initiation Factor 2 Subunit 2 (EIF2S2) ELISA Kit

Sign In for Pricing
View Details
Horse Eukaryotic Translation Initiation Factor 2 Subunit 2 (EIF2S2) ELISA Kit
MBS9913164-04 10x 96 Well

Horse Eukaryotic Translation Initiation Factor 2 Subunit 2 (EIF2S2) ELISA Kit

Sign In for Pricing
View Details
Dnmt1 Rabbit Monoclonal Antibody
AMRe86343-01 1 Each

Dnmt1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Dnmt1 Rabbit Monoclonal Antibody
AMRe86343-02 50 µL

Dnmt1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details