Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KDM6A Protein

This Human KDM6A Protein spans the amino acid sequence from region 1095-1258aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Histone demethylase UTX) (Ubiquitously-transcribed TPR protein on the X chromosome) (Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein) ([histone H3]-trimethyl-L-lysine (27) demethylase 6A)

UniProt

O15550

Expression Region

1095-1258aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PKR (T451) Recombinant Rabbit Monoclonal Antibody [JE46-70]
HA722067 100 µL

Phospho-PKR (T451) Recombinant Rabbit Monoclonal Antibody [JE46-70]

Sign In for Pricing
View Details
Recombinant Human IL11RA/IL11Rα Protein (His Tag)
PKSH031732 100 µg

Recombinant Human IL11RA/IL11Rα Protein (His Tag)

Sign In for Pricing
View Details
Mamdc4 Mouse Gene Knockout Kit (CRISPR)
KN309688BN 1 Kit

Mamdc4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,3-Dihydroxybenzamide
TRC-D451020-25MG 25 mg

2,3-Dihydroxybenzamide

Sign In for Pricing
View Details
Human MAGEB18 activation kit by CRISPRa
GA117303 1 Kit

Human MAGEB18 activation kit by CRISPRa

Sign In for Pricing
View Details
B3GAT1 Rabbit Polyclonal Antibody
ER1901-15 100 µL

B3GAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details