Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MMP8 Protein

This Human MMP8 Protein spans the amino acid sequence from region 101-467aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Matrix metalloproteinase-8) (MMP-8) (PMNL collagenase) (PMNL-CL)

UniProt

P22894

Expression Region

101-467aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAVFQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cystathionine Gamma Lyase (CSE) ELISA Kit
RD-CSE-Ra-48Tests 48 Tests

Rat Cystathionine Gamma Lyase (CSE) ELISA Kit

Sign In for Pricing
View Details
Anti-TRIM36 Antibody Picoband®, PE Conjugate
A10270-3-PE 100 µg/Vial

Anti-TRIM36 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
RHCG Conjugated Antibody
C40211 100 µL

RHCG Conjugated Antibody

Sign In for Pricing
View Details
TRIM9 (NM_015163) Human Tagged Lenti ORF Clone
RC209601L3 10 µg

TRIM9 (NM_015163) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HG-7-85-01-NH2
orb2300273-01 50 mg

HG-7-85-01-NH2

Sign In for Pricing
View Details
HG-7-85-01-NH2
orb2300273-02 10 mg

HG-7-85-01-NH2

Sign In for Pricing
View Details