Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XylF Protein

This xylF Protein spans the amino acid sequence from region 1-281aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(HMSH) (2-hydroxymuconic semialdehyde hydrolase)

UniProt

P23106

Expression Region

1-281aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNAPQQSPEIGREILAAGYRTNLHDQGEGFPALLIHGSGPASPPGPTGAGSFRSSQTRRVIAPDMLGFGYSERPADGKYSQARWVEHAIGVLDALGIQQGDIVGNSFGGGLALALAIRHPERVRRLVLMGSVGVSFPITAGLETAWGYTPSLANMRRLLDLFAHDRTLVNDELAELRYQASIRPGFQESFAAMFPPPRQNGVDDLASNETDIRALPNETLVIHGREDRIIPLQASLTLAQWIPNAQLHVFGQCGHWTQIEHAERFARLVENFLAEADALHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Mouse NMNAT1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)
IRBAMLNMNAT1AP38200UL 1 Each

Rabbit Anti Mouse NMNAT1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)

Sign In for Pricing
View Details
HMGCR CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
23583154 3x 1.0 µg DNA

HMGCR CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
MTCH1 Recombinant Protein Antigen
NBP1-84505PEP 0.1 mL

MTCH1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Magnaporthe oryzae Eukaryotic translation initiation factor 3 subunit B (PRT1), partial
MBS1219461 Inquire

Recombinant Magnaporthe oryzae Eukaryotic translation initiation factor 3 subunit B (PRT1), partial

Sign In for Pricing
View Details
Human Eye Ball (A-CLASS)
4072250/B 1 Each

Human Eye Ball (A-CLASS)

Sign In for Pricing
View Details
Recombinant Paracoccidioides brasiliensis Probable Xaa-Pro aminopeptidase PEPP (PEPP)
MBS1088234-01 0.02 mg (E-Coli)

Recombinant Paracoccidioides brasiliensis Probable Xaa-Pro aminopeptidase PEPP (PEPP)

Sign In for Pricing
View Details