Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANK3 Protein

This Human ANK3 Protein spans the amino acid sequence from region 4088-4199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ANK-3) (Ankyrin-G)

UniProt

Q12955

Expression Region

4088-4199aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2A7 Peptide - N-terminal region (AAP41799)
AAP41799-100UG 100 µg

CYP2A7 Peptide - N-terminal region (AAP41799)

Sign In for Pricing
View Details
N- (7H-Purin-6-yl) acetamide
HY-W424876 1 Each

N- (7H-Purin-6-yl) acetamide

Sign In for Pricing
View Details
RAD21 Cohesin Complex Component (rad21) Antibody
abx218148 100 µg

RAD21 Cohesin Complex Component (rad21) Antibody

Sign In for Pricing
View Details
Brilliant Violet 421™ anti-mouse CD138 (Syndecan-1)
GT04579 50 µg

Brilliant Violet 421™ anti-mouse CD138 (Syndecan-1)

Sign In for Pricing
View Details
HIST1H2BF Protein Vector (Mouse) (pPB-N-His)
PV188811 500 ng

HIST1H2BF Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse IL-11 Protein, Fc Tag (MALS verified)
IL1-M5243-500ug 500 µg

Mouse IL-11 Protein, Fc Tag (MALS verified)

Sign In for Pricing
View Details