Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM Protein

This OSM Protein spans the amino acid sequence from region 22-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

F7GF43

Expression Region

22-252aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR8 Peptide - C-terminal region
orb2008693 100 µg

TLR8 Peptide - C-terminal region

Sign In for Pricing
View Details
PLC β4 (h) -PR
sc-36274-PR 10 µM - 20 µL

PLC β4 (h) -PR

Sign In for Pricing
View Details
Human CFHR4 activation kit by CRISPRa
GA107450 1 Kit

Human CFHR4 activation kit by CRISPRa

Sign In for Pricing
View Details
Bovine Cbp/p300-interacting transactivator 1 (CITED1) ELISA Kit
MBS7242162-01 48 Well

Bovine Cbp/p300-interacting transactivator 1 (CITED1) ELISA Kit

Sign In for Pricing
View Details
Bovine Cbp/p300-interacting transactivator 1 (CITED1) ELISA Kit
MBS7242162-02 96 Well

Bovine Cbp/p300-interacting transactivator 1 (CITED1) ELISA Kit

Sign In for Pricing
View Details
Bovine Cbp/p300-interacting transactivator 1 (CITED1) ELISA Kit
MBS7242162-03 5x 96 Well

Bovine Cbp/p300-interacting transactivator 1 (CITED1) ELISA Kit

Sign In for Pricing
View Details