Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR8 Peptide - C-terminal region

TLR8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD288, MGC119599, MGC119600

UniProt

Q9NR97

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TLR8 Rabbit Polyclonal Antibody (orb584206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_619542

Preservative

Lyophilized powder

AA Sequence

LEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNVVLTENDSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Chloro-2-fluorobenzyl Bromide
TRC-C366300-25G 25 g

3-Chloro-2-fluorobenzyl Bromide

Sign In for Pricing
View Details
THPO Antibody
KC-2408-01 50 μL

THPO Antibody

Sign In for Pricing
View Details
THPO Antibody
KC-2408-02 100 µL

THPO Antibody

Sign In for Pricing
View Details
THPO Antibody
KC-2408-03 1 mL

THPO Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS627586 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein
TP305666L 1 mg

Neurokinin B (TAC3) (NM_013251) Human Recombinant Protein

Sign In for Pricing
View Details