Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STEAP1B Protein

This Human STEAP1B Protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6NZ63

Expression Region

1-245aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESRKDITNQEEIWKMKPRRNLEDNDYLQTAHADEFDCPSELQHAQELFPQWHLPIKIAAVMASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQVHNGTKYKKFPHWLDKWMLTRKQFGLLSLFFAVLHAIYTLSYAMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQVHGRINFLTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY339434
HY-114550 1 Each

LY339434

Sign In for Pricing
View Details
Clear Gel Tray (Small)
34-12018-00 1 Unit

Clear Gel Tray (Small)

Sign In for Pricing
View Details
ATP6V1B1, CT (ATP6V1B1, ATP6B1, VATB, VPP3, V-type proton ATPase subunit B, kidney isoform, Endomembrane proton pump 58kD subunit, Vacuolar proton pump subunit B 1) (APC) discontinued
032297-APC 200 µL

ATP6V1B1, CT (ATP6V1B1, ATP6B1, VATB, VPP3, V-type proton ATPase subunit B, kidney isoform, Endomembrane proton pump 58kD subunit, Vacuolar proton pump subunit B 1) (APC) discontinued

Sign In for Pricing
View Details
SESN3 antibody
70R-20187 50 μL

SESN3 antibody

Sign In for Pricing
View Details
10M Sodium Hydroxide (NaOH) Solution
T5052 1000 mL

10M Sodium Hydroxide (NaOH) Solution

Sign In for Pricing
View Details
Cys-C FIA Test
F2021 25 Tests

Cys-C FIA Test

Sign In for Pricing
View Details