Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDGFRB Protein

This Human PDGFRB Protein spans the amino acid sequence from region 901-1106aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PDGF-R-beta) (PDGFR-beta) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor) (CD140 antigen-like family member B) (Platelet-derived growth factor receptor 1) (PDGFR-1) (CD antigen CD140b)

UniProt

P09619

Expression Region

901-1106aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroethidine [Dihydroethidium] *CAS 104821-25-2*
15200-AAT 25 mg

Hydroethidine [Dihydroethidium] *CAS 104821-25-2*

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 1-257, Fc Tag)
PKSH031964-01 100 µg

Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 1-257, Fc Tag)

Sign In for Pricing
View Details
Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 1-257, Fc Tag)
PKSH031964-02 1 mg

Recombinant Human LILRB4/CD85k/ILT3 Protein (aa 1-257, Fc Tag)

Sign In for Pricing
View Details
CFSE [5- (and 6) -Carboxyfluorescein diacetate, succinimidyl ester] *CAS 150347-59-4*
22022-AAT 25 mg

CFSE [5- (and 6) -Carboxyfluorescein diacetate, succinimidyl ester] *CAS 150347-59-4*

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details