Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AAV2gp07 Protein

This AAV2gp07 Protein spans the amino acid sequence from region 1-533aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Major coat protein VP3)

UniProt

A0A513ZUU9

Expression Region

1-533aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Adeno-associated virus

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLSFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTMSRLQFSQAGASDIRDQSRNWLPGPCYRQQRVSKTAADNNNSDYSWTGATKYHLNGRDSLVNPGPAMASHKDDEEKYFPQSGVLIFGKQDSGKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQSGNTQAATSDVNTQGVLPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRNL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CLASP1 Antibody [Alexa Fluor 594]
NBP1-19127AF594 0.1 mL

Rabbit Polyclonal CLASP1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Recombinant Human GSTM5
MBS7617506-01 0.05 mg

Recombinant Human GSTM5

Sign In for Pricing
View Details
Recombinant Human GSTM5
MBS7617506-02 0.2 mg

Recombinant Human GSTM5

Sign In for Pricing
View Details
Recombinant Human GSTM5
MBS7617506-03 1 mg

Recombinant Human GSTM5

Sign In for Pricing
View Details
Recombinant Human GSTM5
MBS7617506-04 5x 1 mg

Recombinant Human GSTM5

Sign In for Pricing
View Details
RPIA (D-5) Alexa Fluor® 594
sc-515328 AF594 200 µg/mL

RPIA (D-5) Alexa Fluor® 594

Sign In for Pricing
View Details