Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hordeum vulgare subsp. vulgare Horcolin Protein

This Hordeum vulgare subsp. vulgare Horcolin Protein spans the amino acid sequence from region 1-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Agglutinin) (Mannose-specific lectin)

UniProt

P82953

Expression Region

1-146aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Hordeum vulgare subsp. vulgare (Domesticated barley)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSKPVKIGPWGGNGGSERDVQPKPIRMVSMTVSSGAIVDAIAFTYVGTDNVQHSSGIKWGGTGGTEDTINLDATNYVTEISGTVGKFGTDDIVTSLKIITSKGVTRTYGSGTGIPFRVPVLDGGKIAGFFGRAGAFLDAIGFYITP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mimitin (NDUFAF2) Rabbit Polyclonal Antibody
TA379004 100 µL

Mimitin (NDUFAF2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), 0.2mg/mL
BNUB0637-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), 0.2mg/mL

Sign In for Pricing
View Details
PQBP1 (NM_001167992) Human Recombinant Protein
TP329617M 100 µg

PQBP1 (NM_001167992) Human Recombinant Protein

Sign In for Pricing
View Details
Natural Convection Oven BONC-308
BONC-308 1 Unit

Natural Convection Oven BONC-308

Sign In for Pricing
View Details
Recombinant CD25 Monoclonal Antibody
AN301472L-01 50 µL

Recombinant CD25 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CD25 Monoclonal Antibody
AN301472L-02 100 µL

Recombinant CD25 Monoclonal Antibody

Sign In for Pricing
View Details